PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g30033.1.p
Common NameBRADI_3g30033, LOC104584172
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 316aa    MW: 34472.8 Da    PI: 4.7299
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g30033.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.3e-14755148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEd l+++ ++++G g +W   ++t+g+ R++ +c+srw++yl
  Bradi3g30033.1.p  7 KGKWSKEEDNLIKNHIEKYGIGrSWQGLSNTLGLQRCGRSCRSRWLNYL 55
                      79******************999************************97 PP

2Myb_DNA-binding29.91.3e-0962105247
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       g++T+ E+ ++ +   + G+  W+ Ia+ ++ gRt+  +k++w++ 
  Bradi3g30033.1.p  62 GNFTAAEERIICEMYSKRGSC-WSIIAAVLP-GRTDLAIKNYWNST 105
                       89*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.75155IPR017930Myb domain
SuperFamilySSF466891.99E-254102IPR009057Homeodomain-like
SMARTSM007173.4E-9657IPR001005SANT/Myb domain
PfamPF002492.0E-11755IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-19862IPR009057Homeodomain-like
CDDcd001677.73E-9955No hitNo description
PROSITE profilePS5129419.09256110IPR017930Myb domain
SMARTSM007177.9E-1060108IPR001005SANT/Myb domain
PfamPF002492.6E-862105IPR001005SANT/Myb domain
CDDcd001673.44E-763106No hitNo description
Gene3DG3DSA:1.10.10.607.8E-2063109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MRGGMKKGKW SKEEDNLIKN HIEKYGIGRS WQGLSNTLGL QRCGRSCRSR WLNYLRPGLK  60
HGNFTAAEER IICEMYSKRG SCWSIIAAVL PGRTDLAIKN YWNSTLKKRF PRAARSRRRT  120
SSDSSDDTGP DLTLVVYNDD ESTSTTTAPD LALIVYNEEE ESAAEPELPL VVYNEEEESA  180
AAPELPLVLY NEEESATAGS SSSHSSGVDK PVAVLSGSQL QAGLQPPPPI CAPVQAGAQP  240
SPPPVTLVKE ELISAPVRTS PVDYHQTGEE MDVGWALMSP MPLSYMDPDL ARIIGIDLPP  300
IAGFEDIGSF LSFFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-24511025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756009.11e-176PREDICTED: myb-related protein 308-like
TrEMBLA0A0Q3LYH61e-176A0A0Q3LYH6_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122282638
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.11e-41myb domain protein 87